DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha3 and psmb7.2

DIOPT Version :9

Sequence 1:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_002941310.2 Gene:psmb7.2 / 100489016 XenbaseID:XB-GENE-479691 Length:279 Species:Xenopus tropicalis


Alignment Length:172 Identity:47/172 - (27%)
Similarity:83/172 - (48%) Gaps:16/172 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDANVLTSELRLIAQRY 97
            |..||:.:||::|.|:.|:|:.::.:.....||:.:.||:.|..||:.:||..:|..|......:
 Frog    46 TIAGIIYKDGVILGADRRATDDMVVADKNCAKIHYITDNIYCCGAGVAADAENVTQLLSSNLHIH 110

  Fly    98 QFSYG---EVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGYQLYQSDPSGNYGGW 159
            ..:.|   .|....::      :||...:|.|.  .|.|::..|.|.| |.|||...|.|:....
 Frog   111 AMTTGRQPRVCTANRI------LKQFLYRYQGH--IGASIIVGGVDIK-GPQLYSIYPHGSTDRV 166

  Fly   160 KATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIKVLS 201
            ..|.:|:...|||::|:    |:....:.|.:.|.|..:.::
 Frog   167 PFTALGSGSAAAIAVLE----DRFKPNMELEEGKRLVTEAIT 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 47/172 (27%)
proteasome_alpha_type_4 3..219 CDD:239721 47/172 (27%)
psmb7.2XP_002941310.2 proteasome_beta_type_7 45..233 CDD:239732 47/172 (27%)
Pr_beta_C 239..270 CDD:372128
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.