DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and Adcy7

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_445848.1 Gene:Adcy7 / 84420 RGDID:619966 Length:1100 Species:Rattus norvegicus


Alignment Length:304 Identity:87/304 - (28%)
Similarity:141/304 - (46%) Gaps:73/304 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   914 RQLSLEKQRTEELLYQILPRPVAQQLMAGDLVEPEE-------------------FSSVTIYFSD 959
            |:|.:||::.|.||..:||..::..:....:...:|                   ..:|:|.::|
  Rat   222 RKLRVEKRQQENLLLSVLPAHISMGMKLAIIERLKEGGDRHYTPDNNFHSLYVKRHQNVSILYAD 286

  Fly   960 IVGFTELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLPE--PNGDKHARE 1022
            |||||.|.:..||.::|..||:|:..||:|....:..:::.:||.|..|||||.  |.   |||.
  Rat   287 IVGFTRLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPT---HARN 348

  Fly  1023 IALMALDILRAVSSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTG 1087
            ...|.|||..|:.  .:|......|.:|:|:|||:|..||:|.:...|.::...|:.|:|||:.|
  Rat   349 CVKMGLDICEAIK--QVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAG 411

  Fly  1088 QPGKIHVSSATKAILDKFGTFQMEQ--------------------------------------RG 1114
            .||::|::.||...|||  .:::|.                                      :|
  Rat   412 VPGRVHITEATLNHLDK--AYEVEDGHGEQRDPYLKEMNIRTYLVIDPRSQQPPLPSHHLSKPKG 474

  Fly  1115 DVELKGKGTV-TTYWLNSTSEGEARP----PTPQILTTDEVPFP 1153
            |..||.:.:| .|.:|.|.  |.|||    ...:.:::.|:|.|
  Rat   475 DATLKMRASVRVTRYLESW--GAARPFAHLNHRESVSSSEIPIP 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003 9/24 (38%)
CYCc 918..1109 CDD:214485 69/211 (33%)
Guanylate_cyc 945..1131 CDD:278633 70/245 (29%)
Adcy7NP_445848.1 AC_N <21..251 CDD:318454 9/28 (32%)
Guanylate_cyc 272..422 CDD:306677 56/154 (36%)
DUF1053 487..593 CDD:399378 10/32 (31%)
Guanylate_cyc 891..1087 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.