DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and GLR2.5

DIOPT Version :10

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_001332219.1 Gene:GLR2.5 / 830991 AraportID:AT5G11210 Length:918 Species:Arabidopsis thaliana


Alignment Length:52 Identity:12/52 - (23%)
Similarity:20/52 - (38%) Gaps:22/52 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TVCRRW---RTIAYN------------------TQLWKNVSLRPEVS-GLHV 87
            |:|..|   ||:..:                  |::.||..|.|.:: |.|:
plant    24 TICEWWWFRRTVLKHHGIDIKYYQNLLAFVFAVTEINKNPRLLPNITLGFHI 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_GC-like 90..501 CDD:380575
Protein Kinases, catalytic domain 616..885 CDD:473864
HNOBA <891..939 CDD:462234
CYCc 918..1109 CDD:214485
GLR2.5NP_001332219.1 PBP1_GABAb_receptor_plant 38..421 CDD:380645 7/38 (18%)
GluR_Plant 456..806 CDD:270404
Lig_chan 584..838 CDD:459656
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.