DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and Adcy5

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_072122.2 Gene:Adcy5 / 64532 RGDID:71014 Length:1262 Species:Rattus norvegicus


Alignment Length:243 Identity:83/243 - (34%)
Similarity:133/243 - (54%) Gaps:35/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   915 QLSLEKQRTEE-------LLYQILPRPVAQQLMA----GDLVEPEEFSSVTIYFSDIVGFT---- 964
            |.:.||:..||       ||:.|||:.||...:|    .|.:..:....|.:.|:.|..|:    
  Rat  1022 QATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYV 1086

  Fly   965 ELCARSSPMDVVNFLNDLYSTFDRIIG---FYDVYKVETIGDAYLVVSGLPEPNGDKHAR----- 1021
            ||.|.:..::.:..||::.:.||.||.   |..:.|::|||..|:..|||.:...||..:     
  Rat  1087 ELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKAGKTHIKA 1151

  Fly  1022 --EIALMALDILRAVS--SFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASR 1082
              :.|:..:|.::.::  |||       ..|::||::.|.|.|||:|.:.|.|.::|:|||.|||
  Rat  1152 LADFAMKLMDQMKYINEHSFN-------NFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASR 1209

  Fly  1083 MESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVELKGKGTVTTYWLN 1130
            |:|||.|.:|.|::....:| ...|:|:|.||.|::||||.:.||:||
  Rat  1210 MDSTGVPDRIQVTTDMYQVL-AANTYQLECRGVVKVKGKGEMMTYFLN 1256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003 12/30 (40%)
CYCc 918..1109 CDD:214485 69/217 (32%)
Guanylate_cyc 945..1131 CDD:278633 69/202 (34%)
Adcy5NP_072122.2 AC_N 1..459 CDD:318454
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..196
Guanylate_cyc 461..634 CDD:306677
DUF1053 669..761 CDD:399378
Guanylate_cyc 1063..1257 CDD:306677 69/202 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.