DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and adcy7

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:XP_021333246.1 Gene:adcy7 / 568726 ZFINID:ZDB-GENE-040713-1 Length:1119 Species:Danio rerio


Alignment Length:259 Identity:83/259 - (32%)
Similarity:134/259 - (51%) Gaps:42/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   882 IMKG-FCENLMDDLLNRMEQYANNLESL-VEEKTRQLSLEKQRTEELLYQILPRPVA-------- 936
            ||.| |.:.||:..|.  :.:.:.|..| :..|   |.:||::.|.||..:||..::        
Zfish   190 IMVGIFHKVLMEKALK--QTFQDTLRCLGIRMK---LEIEKRQQENLLQSVLPVYISMKMKLAIM 249

  Fly   937 ----------QQLMAGD------LVEPEEFSSVTIYFSDIVGFTELCARSSPMDVVNFLNDLYST 985
                      ||.|..|      .|:..|  :|:|.::||||||.|.:..||.::|..||:|:..
Zfish   250 ERCKCKDKEEQQRMVRDNNFHSLYVKRHE--NVSILYADIVGFTRLASDCSPKELVLMLNELFGK 312

  Fly   986 FDRIIGFYDVYKVETIGDAYLVVSGLPE--PNGDKHAREIALMALDILRAVSSFNLRHKPEYKIQ 1048
            ||:|....:..:::.:||.|..|||||.  ||   ||:....|.||:..|:.  .:|......|.
Zfish   313 FDQIAKENECMRIKILGDCYYCVSGLPVSLPN---HAKNCVKMGLDMCEAIK--QVREATGVDIN 372

  Fly  1049 IRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQ 1112
            :|:|:|||:|..||:|.:...:.::...|..|:.|||.|.||::|::.||...|:|  .:::|:
Zfish   373 MRVGVHSGNVLCGVIGLRKWQFDVWSHDVTLANHMESGGLPGRVHITEATLKHLNK--AYEVEE 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357 2/2 (100%)
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003 19/76 (25%)
CYCc 918..1109 CDD:214485 71/216 (33%)
Guanylate_cyc 945..1131 CDD:278633 61/170 (36%)
adcy7XP_021333246.1 AC_N <129..248 CDD:318454 18/62 (29%)
Guanylate_cyc 272..455 CDD:306677 61/172 (35%)
DUF1053 487..613 CDD:310728
Guanylate_cyc 909..1106 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.