DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and adcy1a

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_001161821.1 Gene:adcy1a / 557026 ZFINID:ZDB-GENE-070705-302 Length:1114 Species:Danio rerio


Alignment Length:207 Identity:70/207 - (33%)
Similarity:116/207 - (56%) Gaps:16/207 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   915 QLSLEKQRTEELLYQILPRPVAQQLMAGDLVEPEE----------FSSVTIYFSDIVGFTELCAR 969
            ||..|.::.|.||..:|||.||.: |..|.::|.|          ..:|:|.|:||||||.|.::
Zfish   248 QLEDENEKQERLLMSLLPRNVAME-MKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQ 311

  Fly   970 SSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLPEPNGDKHAREIALMALDILRAV 1034
            .:..::|..||:|:..||.:.......:::.:||.|..||||.:|..| ||.....|.||::..:
Zfish   312 CTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKAD-HAHCCVEMGLDMIDTI 375

  Fly  1035 SSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATK 1099
            :|  :....|..:.:|:|:|:|.|..||:|.:...|.::.:.|..|:.||:.|.|||:|::.||.
Zfish   376 TS--VAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANMMEAGGLPGKVHITKATL 438

  Fly  1100 AILDKFGTFQME 1111
            ..|:  |.:::|
Zfish   439 ECLN--GDYEVE 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003 11/23 (48%)
CYCc 918..1109 CDD:214485 67/200 (34%)
Guanylate_cyc 945..1131 CDD:278633 57/177 (32%)
adcy1aNP_001161821.1 AC_N <154..285 CDD:292831 15/37 (41%)
CYCc 251..446 CDD:214485 67/200 (34%)
Guanylate_cyc 287..469 CDD:278633 55/167 (33%)
DUF1053 513..601 CDD:283888
CYCc 819..1029 CDD:214485
Guanylate_cyc 852..1048 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.