DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and Gucy1b1

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_059497.1 Gene:Gucy1b1 / 54195 MGIID:1860604 Length:620 Species:Mus musculus


Alignment Length:556 Identity:151/556 - (27%)
Similarity:234/556 - (42%) Gaps:128/556 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   658 EIKQARDVSHENTVRFVGA-------CIDLPRPTVLILTEYCSRGSLKDVLENEAIELDWNFRMS 715
            |..|..|..|::.......       |.|..:...|||..|..|..|:|::            :.
Mouse    96 EFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIV------------IG 148

  Fly   716 LIHDIVKGMNYLHNSDV---AAHGKLRSCNCLIDGRFVLKISDFGLRTLTTPSDFVRDQNYYLKL 777
            :|..:.:   .:|.:::   ....:...|:   ..:|:::..:      :...||..|.:.:.:.
Mouse   149 IIKTVAQ---QIHGTEIDMKVIQQRNEECD---HTQFLIEEKE------SKEEDFYEDLDRFEEN 201

  Fly   778 LWIAPELLPLTTIPGCCPATQRGDVYSFGIILEE--IVNRGG-------------------PYQE 821
            ......:.|.|    .|.|      :.|.||.:.  :|.:.|                   .:..
Mouse   202 GTQESRISPYT----FCKA------FPFHIIFDRNLVVTQCGNAIYRVLPQLQPGNCSLLSVFSL 256

  Fly   822 ARQQMDV--HTILHKVRQCNGFRPLIRERECPPDLLELMEKCWADNQEERPTFSTIRSNIRTIMK 884
            .|..:|:  |.||..:....    ::|.:|   .||: :||...:::......|.:|...:.|..
Mouse   257 VRPHIDISFHGILSHINTVF----VLRSKE---GLLD-VEKLECEDELTGAEISCLRLKGQMIYL 313

  Fly   885 GFCENL----------MDDLLNR-----------------------MEQY--ANNLESLVEE--- 911
            ...:::          :|||..|                       .|:|  ...||.|.:.   
Mouse   314 PEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQL 378

  Fly   912 KTRQLSLEKQRTEELLYQILPRPVAQQLMAGDLVEPEEFSSVTIYFSDIVGFTELCAR----SSP 972
            ..|.|..||::|:.|||.:||..||.:|.....|..:.:.:|||.||.||||...|::    ...
Mouse   379 TLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGA 443

  Fly   973 MDVVNFLNDLYSTFDRIIGFYD---VYKVETIGDAYLVVSGLPEPNGDKHAREIALMALDILRAV 1034
            |.:||.|||||:.||.:.....   ||||||:||.|:.||||||| ...|||.|..:|||::...
Mouse   444 MKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEP-CIHHARSICHLALDMMEIA 507

  Fly  1035 SSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATK 1099
            ....:..:   .:||.||:|:|.|..||:|::||.|||||:|||..||.|:||:.|||:||..|.
Mouse   508 GQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTY 569

  Fly  1100 AIL----DKFGTFQMEQRGDVELKGKGTVTTYWLNS 1131
            ..|    :....|.:|.||.|.:|||......|..|
Mouse   570 RCLMSPENSDPLFHLEHRGPVSMKGKKEPMQVWFLS 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357 43/259 (17%)
TyrKc 627..877 CDD:197581 41/251 (16%)
HNOBA <882..939 CDD:285003 22/94 (23%)
CYCc 918..1109 CDD:214485 87/201 (43%)
Guanylate_cyc 945..1131 CDD:278633 85/196 (43%)
Gucy1b1NP_059497.1 HNOB 2..166 CDD:311572 15/84 (18%)
HNOBA 207..406 CDD:311573 44/216 (20%)
Guanylate_cyc 412..605 CDD:306677 85/196 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.