DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and NPR3

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_001191304.1 Gene:NPR3 / 4883 HGNCID:7945 Length:541 Species:Homo sapiens


Alignment Length:501 Identity:143/501 - (28%)
Similarity:235/501 - (46%) Gaps:89/501 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FDLERCGPAVDLALDEI-----NKVFLKPHNITLLKKKGSYPSCSGARA-----PGLAADMYFQD 157
            |.|.|..||::.||..:     .:..|.|.....:..:.|  .| |.||     ..:||....:.
Human    67 FSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDS--DC-GNRALFSLVDRVAAARGAKP 128

  Fly   158 DVIAFIGPACAFALEPVARLAAYWNKPIITGMGDQPPSSEGELTVTSGILGRIHKWKNENTGMFK 222
            |:|  :||.|.:|..||||||::|:.|::         |.|.|..     |..||          
Human   129 DLI--LGPVCEYAAAPVARLASHWDLPML---------SAGALAA-----GFQHK---------- 167

  Fly   223 DKSKYPTLTRMSYCQCRLILVFASVIRQFNWNHVALLV--DRSELFSWTVGKNLEYGLRQEGLLS 285
             .|:|..|||::....::..:..::.|..:|:..||:.  |:.|...:...:.:....::|||.:
Human   168 -DSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHT 231

  Fly   286 FVKELNGNEEEVYENYLKDASMYARVVILSVRGVLVRKFMLAAHSLGMTNGEWVFLDVEIFQSEY 350
            .:...:..::...|:.:::.....||||:......:|..||.||..|||:|::.|.::|:|.|..
Human   232 SIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSS 296

  Fly   351 WGDKGWEMKDEHDAKARKAYEALLRVSLLQPTSPKFQDFADNVRENA------LYDYNYTFGEGE 409
            :||..|:..|:||.:|::||.:|..|:||:...|:|:.|:..|:.:.      :.||        
Human   297 YGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDY-------- 353

  Fly   410 EVNFFIGAFYDGVYLLGMALNETLTEGGDIRDGVNITRRMWNRTFEGITGHVRIDDNGDRDADYS 474
             ||.|:..|:|.:.|..:||:|.|..|...:||..|.::.||||||||.|.|.||.||||..|:|
Human   354 -VNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFS 417

  Fly   475 ILDLDPINGKFSVVAHYSGVHKVYSAVHGKKIHWPGGREEPPPDVP-PCGFL------------G 526
            ::.:..:.         :|..:|.....||:     ||.|..|:|. |.|.|            .
Human   418 VIAMTDVE---------AGTQEVIGDYFGKE-----GRFEMRPNVKYPWGPLKLRIDENRIVEHT 468

  Fly   527 NSTDCVGN----FSTIMYSVFGLLLFLGLVFLVICLLQKQMKLSKE 568
            ||:.|..:    .|.:...|.|.||..||: :.....:|:.:::.|
Human   469 NSSPCKSSGGLEESAVTGIVVGALLGAGLL-MAFYFFRKKYRITIE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368 120/410 (29%)
ANF_receptor 107..479 CDD:279440 117/389 (30%)
PKc_like 616..885 CDD:304357
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003
CYCc 918..1109 CDD:214485
Guanylate_cyc 945..1131 CDD:278633
NPR3NP_001191304.1 PBP1_NPR_C_like 54..446 CDD:107381 126/431 (29%)
ANF_receptor 71..422 CDD:279440 117/389 (30%)
TM_EphA1 476..507 CDD:214014 7/31 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.876977 Normalized mean entropy S7115
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.