DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and Adcy1

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_033752.1 Gene:Adcy1 / 432530 MGIID:99677 Length:1118 Species:Mus musculus


Alignment Length:213 Identity:71/213 - (33%)
Similarity:120/213 - (56%) Gaps:17/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   909 VEEKTRQLSLEKQRTEELLYQILPRPVAQQLMAGDLVEPEE----------FSSVTIYFSDIVGF 963
            :|::.| |..|.::.|.||..:|||.||.: |..|.::|.|          ..:|:|.|:|||||
Mouse   249 IEDRLR-LEDENEKQERLLMSLLPRNVAME-MKEDFLKPPERIFHKIYIQRHDNVSILFADIVGF 311

  Fly   964 TELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLPEPNGDKHAREIALMAL 1028
            |.|.::.:..::|..||:|:..||.:.......:::.:||.|..||||.:|..| ||.....|.|
Mouse   312 TGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTD-HAHCCVEMGL 375

  Fly  1029 DILRAVSSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIH 1093
            |::..::|  :....|..:.:|:|:|:|.|..||:|.:...|.::.:.|..|:.||:.|.|||:|
Mouse   376 DMIDTITS--VAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVH 438

  Fly  1094 VSSATKAILDKFGTFQME 1111
            ::..|.|.|:  |.:::|
Mouse   439 ITKTTLACLN--GDYEVE 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003 12/29 (41%)
CYCc 918..1109 CDD:214485 67/200 (34%)
Guanylate_cyc 945..1131 CDD:278633 57/177 (32%)
Adcy1NP_033752.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
AC_N <158..291 CDD:292831 16/43 (37%)
CYCc 257..452 CDD:214485 67/200 (34%)
Guanylate_cyc 293..475 CDD:278633 55/167 (33%)
Interaction with calmodulin. /evidence=ECO:0000250 492..519
CYCc 825..1036 CDD:214485
Guanylate_cyc 858..1055 CDD:278633
Interaction with calmodulin. /evidence=ECO:0000250 1023..1046
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1079..1118
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.