DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and CG14877

DIOPT Version :10

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:170 Identity:32/170 - (18%)
Similarity:62/170 - (36%) Gaps:42/170 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 LERCGPAVDLALDEINKVFLKPHNITLLKKKGSYPSCSGARAPGLAADMYFQDDVIAFIGPACAF 169
            |.|..|.:.:|..:|....|.|.:|. .:.......|..:.....|.|...:.......||.|.:
  Fly    58 LPRVLPILKVAEQQIRSKSLIPSHID-FEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDY 121

  Fly   170 ALEPVARLAAYWNKPIITGMGDQPPSSEGELTVTSGILGRIHKWKNE------------NTGMFK 222
            :|..|:|:..|:|             |:|...::.|  |..:.::.:            .|||. 
  Fly   122 SLAAVSRITKYFN-------------SQGTPLISVG--GSTYDFEQKKTDCNDEFYMLLRTGML- 170

  Fly   223 DKSKYPTLTRMSYCQCRLILVFASVIRQFNWNHVALLVDR 262
               .:.|::.::          .:|:::.||:|.....:|
  Fly   171 ---SFETISELT----------INVMKRHNWSHSIFYYER 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_GC-like 90..501 CDD:380575 32/170 (19%)
Protein Kinases, catalytic domain 616..885 CDD:473864
HNOBA <891..939 CDD:462234
CYCc 918..1109 CDD:214485
CG14877NP_650507.1 Periplasmic_Binding_Protein_type1 45..>251 CDD:471960 32/170 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.