DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and CG14877

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:170 Identity:32/170 - (18%)
Similarity:62/170 - (36%) Gaps:42/170 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 LERCGPAVDLALDEINKVFLKPHNITLLKKKGSYPSCSGARAPGLAADMYFQDDVIAFIGPACAF 169
            |.|..|.:.:|..:|....|.|.:|. .:.......|..:.....|.|...:.......||.|.:
  Fly    58 LPRVLPILKVAEQQIRSKSLIPSHID-FEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDY 121

  Fly   170 ALEPVARLAAYWNKPIITGMGDQPPSSEGELTVTSGILGRIHKWKNE------------NTGMFK 222
            :|..|:|:..|:|             |:|...::.|  |..:.::.:            .|||. 
  Fly   122 SLAAVSRITKYFN-------------SQGTPLISVG--GSTYDFEQKKTDCNDEFYMLLRTGML- 170

  Fly   223 DKSKYPTLTRMSYCQCRLILVFASVIRQFNWNHVALLVDR 262
               .:.|::.::          .:|:::.||:|.....:|
  Fly   171 ---SFETISELT----------INVMKRHNWSHSIFYYER 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368 32/170 (19%)
ANF_receptor 107..479 CDD:279440 31/168 (18%)
PKc_like 616..885 CDD:304357
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003
CYCc 918..1109 CDD:214485
Guanylate_cyc 945..1131 CDD:278633
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 32/170 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.876977 Normalized mean entropy S7115
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.