DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and CG31183

DIOPT Version :10

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_650505.2 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster


Alignment Length:70 Identity:17/70 - (24%)
Similarity:31/70 - (44%) Gaps:16/70 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 CVLSGMTHITDQLWMSIMPILTNIRIIV---MGTTERLGGNIHVDQLMDTIGSHCTKLERLELRW 439
            |:|:         ::.|:.|:..:.:|:   :||...|  .||...|:..|.  |.....|.::.
  Fly    34 CILA---------FLVIVVIIAALLLILNWNIGTWTTL--IIHAILLLGVIA--CAGALFLAMKT 85

  Fly   440 DPENL 444
            :.|||
  Fly    86 EKENL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_GC-like 90..501 CDD:380575 17/70 (24%)
Protein Kinases, catalytic domain 616..885 CDD:473864
HNOBA <891..939 CDD:462234
CYCc 918..1109 CDD:214485
CG31183NP_650505.2 PBP1_NPR-like 87..493 CDD:380596 3/4 (75%)
PK_GC-A_B 589..883 CDD:270944
HNOBA <890..938 CDD:462234
CYCc 917..1108 CDD:214485
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.