DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and CG32301

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster


Alignment Length:346 Identity:87/346 - (25%)
Similarity:153/346 - (44%) Gaps:78/346 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   840 GFRPLIRERECPPDLLELMEKCWADNQEERPTFSTIRSNIRTIMKGFCENLMDDLLNRMEQYANN 904
            |:..||       |.:..::|.|     |...:....         |..|::...|:|.::|  |
  Fly   177 GYMALI-------DKISTLDKVW-----ELTAYGAYL---------FFLNMLCMFLSRFQEY--N 218

  Fly   905 LES--------LVEEKTRQLSLEKQRTEELLYQILPRPVAQQL---MAGDLVEP----------- 947
            :.|        :.:....|:::::::.  ||..|:|..:|:.|   :|..:.|.           
  Fly   219 MRSGILSRYQVVYQNLVFQMAMKEEKA--LLDSIIPVTLARSLQDAIASHIEEDPSNLMPFTKTR 281

  Fly   948 ----EEFSSVTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVV 1008
                |....|:|..:|:|.||.|.......|:|..|::|:.:||.........:::.:||:|..|
  Fly   282 HLFMEPHPEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCV 346

  Fly  1009 SGLPE--PNGDKHAREIALMALDIL---RAVSSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMP 1068
            :|:|.  |.   ||......|||::   |.||  ..|:|   ||.:|||:|||.:.||::|....
  Fly   347 TGIPSYFPT---HANACVNQALDMIEISREVS--KRRNK---KIDLRIGVHSGEILAGIIGLTKW 403

  Fly  1069 HYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDV----ELKGKGTVTTYWL 1129
            .:.::...|:..:|:||:|.||.:|:||.|..:||..  :..|:..|.    .|..:..::||.:
  Fly   404 QFDIWSKDVDITNRLESSGLPGMVHISSRTLGLLDNH--YVYEEGTDTAKLDPLLQRSNLSTYLI 466

  Fly  1130 NSTSEGEARPPTPQILTTDEV 1150
            .|.        .|....||::
  Fly   467 RSR--------LPNFEDTDDL 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357 7/44 (16%)
TyrKc 627..877 CDD:197581 7/36 (19%)
HNOBA <882..939 CDD:285003 13/64 (20%)
CYCc 918..1109 CDD:214485 63/213 (30%)
Guanylate_cyc 945..1131 CDD:278633 61/209 (29%)
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 54/163 (33%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.