Sequence 1: | NP_726013.2 | Gene: | CG3216 / 37376 | FlyBaseID: | FBgn0034568 | Length: | 1161 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259575.1 | Gene: | Ac13E / 32485 | FlyBaseID: | FBgn0022710 | Length: | 1703 | Species: | Drosophila melanogaster |
Alignment Length: | 235 | Identity: | 73/235 - (31%) |
---|---|---|---|
Similarity: | 123/235 - (52%) | Gaps: | 39/235 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 914 RQLSLEKQRTEELLYQILPRPVAQQLM---------AGDLVEPE--------------------- 948
Fly 949 -EFSSVTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLP 1012
Fly 1013 EPNGDKHAREIALMALDILRAVSSFNL-RHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDT 1076
Fly 1077 VNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDV 1116 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3216 | NP_726013.2 | PBP1_NPR_like | 90..496 | CDD:107368 | |
ANF_receptor | 107..479 | CDD:279440 | |||
PKc_like | 616..885 | CDD:304357 | |||
TyrKc | 627..877 | CDD:197581 | |||
HNOBA | <882..939 | CDD:285003 | 10/24 (42%) | ||
CYCc | 918..1109 | CDD:214485 | 68/222 (31%) | ||
Guanylate_cyc | 945..1131 | CDD:278633 | 59/195 (30%) | ||
Ac13E | NP_001259575.1 | CYCc | 302..518 | CDD:214485 | 68/222 (31%) |
Guanylate_cyc | 361..535 | CDD:278633 | 57/171 (33%) | ||
CYCc | 1362..1556 | CDD:214485 | |||
Guanylate_cyc | 1388..1575 | CDD:278633 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |