DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and rut

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster


Alignment Length:247 Identity:81/247 - (32%)
Similarity:136/247 - (55%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   919 EKQRTEELLYQILPRPVAQQLMAGDLVEP----------EEFSSVTIYFSDIVGFTELCARSSPM 973
            |.::.|.||..:||:.||.| |..|::.|          ::..:|:|.|:||||||.|.::.|..
  Fly   231 ENEKLERLLLSVLPQHVAMQ-MKNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQCSAQ 294

  Fly   974 DVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLPEPNGDKHAREIALMALDILRAVSSFN 1038
            ::|..||:|:..||::.......:::.:||.|..|||||||..| ||:....|.||::.|:::  
  Fly   295 ELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPRKD-HAKCAVEMGLDMIDAIAT-- 356

  Fly  1039 LRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILD 1103
            :....:..:.:|:|:|:|.|..||:|.:...:.::.:.|..|:.|||.|:||::||   |:|.||
  Fly   357 VVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHV---TRATLD 418

  Fly  1104 KF-GTFQMEQ-RGDVE---LKGKGTVTTYWLNSTSEGEARPP---TPQILTT 1147
            .. |.:::|. .||..   |:..| |.|:::       ..||   .|.:|.|
  Fly   419 SLSGEYEVEAGHGDERSSYLRDHG-VDTFFI-------VPPPHRRKPLMLNT 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003 8/19 (42%)
CYCc 918..1109 CDD:214485 69/200 (35%)
Guanylate_cyc 945..1131 CDD:278633 65/200 (33%)
rutNP_511156.2 AC_N <17..255 CDD:292831 10/24 (42%)
CYCc 230..425 CDD:214485 69/200 (35%)
Guanylate_cyc 266..438 CDD:278633 60/177 (34%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.