DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and GUCY1A2

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_001243353.1 Gene:GUCY1A2 / 2977 HGNCID:4684 Length:763 Species:Homo sapiens


Alignment Length:651 Identity:186/651 - (28%)
Similarity:269/651 - (41%) Gaps:162/651 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 VFGLLL----FLGLVFLVICLLQKQMKLSKELNNMSWRVRPDDVLIEMGG--------------- 587
            |.|:|.    .|||.|..|     |.:..:|..|:.:. ..:.||..:||               
Human   151 VSGILQCTANILGLKFEEI-----QKRFGEEFFNICFH-ENERVLRAVGGTLQDFFNGFDALLEH 209

  Fly   588 ---MFGSKGGLQ-------RLDVENISLQQFGIHSGRASIASFTSLPPQVYTTIGQFKGERVAIK 642
               .||.:..|:       .|....:.|..|..|    .|..|..|        |..|.....|.
Human   210 IRTSFGKQATLESPSFLCKELPEGTLMLHYFHPH----HIVGFAML--------GMIKAAGKKIY 262

  Fly   643 KVNVKKVDLTPQLLWEIKQARDVSHENTVRFVGACIDLPRP----TVLILTEYCSRGSLKDVLEN 703
            :::|           |::|   |::|.      .|.|:..|    .:..|.:.|...::...|..
Human   263 RLDV-----------EVEQ---VANEK------LCSDVSNPGNCSCLTFLIKECENTNIMKNLPQ 307

  Fly   704 EAIELDWNFRMS-----------LIHDIVKGMNYLHNSDVAAHGKLRSCNCLIDGRFVLKISD-F 756
            ...::..:.|:|           |:.|  ..|:.|.    ...|..:...|  |...|||..| |
Human   308 GTSQVPADLRISINTFCRAFPFHLMFD--PSMSVLQ----LGEGLRKQLRC--DTHKVLKFEDCF 364

  Fly   757 GLRTLTTPSDFVRDQNYYLKLLWIAPELLPLTTIPGCCPATQRGDVYSFGIILEEIVNRGGPYQE 821
            .:.:....:.|.|             .||.|:|     |...|....:.|...::.|      .|
Human   365 EIVSPKVNATFER-------------VLLRLST-----PFVIRTKPEASGSENKDKV------ME 405

  Fly   822 ARQQMDVHTILHKVRQCNGFRPLIRERECPPDLLELMEKCWADNQEERPTFSTIRSNIRTIMKGF 886
            .:.|| :|     |.:.|..  |.....|...|.|||.:  ..:..:.|.....|.   .|:.|.
Human   406 VKGQM-IH-----VPESNSI--LFLGSPCVDKLDELMGR--GLHLSDIPIHDATRD---VILVGE 457

  Fly   887 CENLMDDLLNRMEQYANNLESLVEEKTRQLSLEKQRTEELLYQILPRPVAQQLMAGDLVEPEEFS 951
            .....|.|..||::    |::.:|...:.|..||::|.:|||.|.|..|||||..|..|:..:|.
Human   458 QAKAQDGLKKRMDK----LKATLERTHQALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFD 518

  Fly   952 SVTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLPEPNG 1016
            .||:.||||||||.:||:.:||.|::.||:||:.||...||.|:||||||||||.|.:|| ....
Human   519 DVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGL-HRKS 582

  Fly  1017 DKHAREIALMALDIL-------------------RAVSSFNL-------RHKPEYKI---QIRIG 1052
            ..||:.||||||.::                   ..:.||.:       :|:.|..:   ::|||
Human   583 LCHAKPIALMALKMMELSEEVLTPDGRPIQPQRSELLFSFPVSIQLVPDQHQSETDLGTEKMRIG 647

  Fly  1053 MHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVE 1117
            :|||||.|||||.:||.|||||:.|..||:.||...|.:|:||..|..:|.:..:|....|...|
Human   648 IHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKREESFTFIPRSREE 712

  Fly  1118 L 1118
            |
Human   713 L 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357 56/284 (20%)
TyrKc 627..877 CDD:197581 51/265 (19%)
HNOBA <882..939 CDD:285003 20/56 (36%)
CYCc 918..1109 CDD:214485 96/219 (44%)
Guanylate_cyc 945..1131 CDD:278633 86/203 (42%)
GUCY1A2NP_001243353.1 HNOB <159..270 CDD:285002 27/139 (19%)
HNOBA 316..503 CDD:285003 55/235 (23%)
CYCc 485..705 CDD:214485 97/220 (44%)
Guanylate_cyc 514..729 CDD:278633 85/201 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.