DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and Adcy10

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_766617.2 Gene:Adcy10 / 271639 MGIID:2660854 Length:1614 Species:Mus musculus


Alignment Length:230 Identity:61/230 - (26%)
Similarity:94/230 - (40%) Gaps:49/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   887 CENLMD-----DLLNRMEQYANNLESLVEEKTRQLSLEKQRTEELLYQILPRPVAQQLMAGDLVE 946
            |...||     |..|.: :.|..|||   :...:|||:|...|.:|.||..:.:...|       
Mouse   233 CMGFMDYYPSGDHKNFL-RLACMLES---DPELELSLQKYVMEIILKQIDDKQLRGYL------- 286

  Fly   947 PEEFSSVTIYFSDIVGFTE--------LCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGD 1003
             .|...|||.|.::: |.|        ...:::.:.:.:.|.......:::..|       ..|.
Mouse   287 -SELRPVTIVFVNLM-FKEQDKVEVIGSAIQAACVHITSVLKVFRGQINKVFMF-------DKGC 342

  Fly  1004 AYLVVSGLP---EPNGDKHAREIALMALDILRAVSSFNLRHKPEYKIQ-IRIGMHSGSVCAGVVG 1064
            ::|.|.|.|   .|:...||.|.|:...|....|          :||: :.||:.||.|..|:||
Mouse   343 SFLCVFGFPGEKAPDEITHALESAVDIFDFCSQV----------HKIRTVSIGVASGIVFCGIVG 397

  Fly  1065 KKMPH-YCLFGDTVNTASRMESTGQPGKIHVSSAT 1098
            ..:.| |.:.|..||.|:|| ....||.:...|.|
Mouse   398 HTVRHEYTVIGQKVNIAARM-MMYYPGIVSCDSVT 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003 17/56 (30%)
CYCc 918..1109 CDD:214485 50/194 (26%)
Guanylate_cyc 945..1131 CDD:278633 43/167 (26%)
Adcy10NP_766617.2 CHD 40..214 CDD:143636
CHD 292..461 CDD:143636 42/159 (26%)
COG3899 485..>959 CDD:226415
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.