DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and ADCY4

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_001185497.1 Gene:ADCY4 / 196883 HGNCID:235 Length:1077 Species:Homo sapiens


Alignment Length:434 Identity:113/434 - (26%)
Similarity:178/434 - (41%) Gaps:128/434 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   770 DQ-NYYLKLLWIAPELLPL----TTIPGCCPATQRGDVYSFGIILEEIVNRGGPYQEARQQM--- 826
            || :|:|.:::.|..:|||    ..:.|.  |:....:...|:.|       ||..::|..:   
Human   118 DQVSYFLFVIFTAYAMLPLGMRDAAVAGL--ASSLSHLLVLGLYL-------GPQPDSRPALLPQ 173

  Fly   827 -----------DVHTILHKVRQCNGFRPLIRERECPPDLLELMEKCWADNQEERPTFSTIRSNIR 880
                       :|..:.||.                     |||:..      |.||....|::.
Human   174 LAANAVLFLCGNVAGVYHKA---------------------LMERAL------RATFREALSSLH 211

  Fly   881 TIMKGFCENLMDDLLNRMEQYANNLESLVEEKTRQLSLEKQRTEELLYQILPRPVAQQ------- 938
            :                               .|:|..||:..|.||..|||..:|::       
Human   212 S-------------------------------RRRLDTEKKHQEHLLLSILPAYLAREMKAEIMA 245

  Fly   939 -LMAGDLVEPEEFSS-----------VTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIG 991
             |.||....||..::           |::.::||||||.|.:..||.::|..||:|:..||:|..
Human   246 RLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAK 310

  Fly   992 FYDVYKVETIGDAYLVVSGLPEPNGDKHAREIALMALDILRAVSSFNLRHKPEYKIQIRIGMHSG 1056
            .::..:::.:||.|..|||||....| ||.....|.||:.||:.  .||......|.:|:|:|||
Human   311 EHECMRIKILGDCYYCVSGLPLSLPD-HAINCVRMGLDMCRAIR--KLRAATGVDINMRVGVHSG 372

  Fly  1057 SVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRG----DVE 1117
            ||..||:|.:...|.::...|..|:.||:.|.||::|::.||.|:|  .|.:.:|..|    |..
Human   373 SVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALL--AGAYAVEDAGMEHRDPY 435

  Fly  1118 LKGKGTVTTYWLNSTSEGEARPPT--------------PQILTT 1147
            |:..|..|...::..:|.|....|              |.:|.|
Human   436 LRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMT 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357 25/133 (19%)
TyrKc 627..877 CDD:197581 24/125 (19%)
HNOBA <882..939 CDD:285003 11/64 (17%)
CYCc 918..1109 CDD:214485 74/209 (35%)
Guanylate_cyc 945..1131 CDD:278633 68/200 (34%)
ADCY4NP_001185497.1 AC_N <115..246 CDD:292831 36/194 (19%)
CYCc 219..422 CDD:214485 74/207 (36%)
Guanylate_cyc 264..418 CDD:278633 58/156 (37%)
DUF1053 479..583 CDD:283888 1/1 (100%)
CYCc 827..1042 CDD:214485
Guanylate_cyc 864..1063 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.