DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and Npr3

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:556 Identity:157/556 - (28%)
Similarity:249/556 - (44%) Gaps:95/556 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LAGLNASDAG-LEQRMYERSRESKSTQLSRYTEVGEMGSTMRVYNVGVLMASHLDSP--FDLERC 108
            |||..:|.|| .......|:||:.:.|                 .:.||:....|..  |.|.|.
Mouse    20 LAGGASSGAGDTRPGSRRRAREALAAQ-----------------KIEVLVLLPRDDSYLFSLARV 67

  Fly   109 GPAVDLALDEI-----NKVFLKPHNITLLKKKGSYPSCSGARA-----PGLAADMYFQDDVIAFI 163
            .||::.||..:     .:..|.|.....:..:.|  .| |.||     ..:||....:.|:|  :
Mouse    68 RPAIEYALRSVEGNGTGRKLLPPGTRFQVAYEDS--DC-GNRALFSLVDRVAAARGAKPDLI--L 127

  Fly   164 GPACAFALEPVARLAAYWNKPIITGMGDQPPSSEGELTVTSGILGRIHKWKNENTGMFKDKSKYP 228
            ||.|.:|..||||||::|:.|::         |.|.|..     |..||           .::|.
Mouse   128 GPVCEYAAAPVARLASHWDLPML---------SAGALAA-----GFQHK-----------DTEYS 167

  Fly   229 TLTRMSYCQCRLILVFASVIRQFNWNHVALLV--DRSELFSWTVGKNLEYGLRQEGLLSFVKELN 291
            .|||::....::..:..::.|..:|:..||:.  |:.|...:...:.:....::|||.:...   
Mouse   168 HLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSAY--- 229

  Fly   292 GNEEEVYENYLKDASMY----ARVVILSVRGVLVRKFMLAAHSLGMTNGEWVFLDVEIFQSEYWG 352
             |.:|..:..|.|...|    .||||:...|..:|:.|||.|..|||:|::.|.::|:|.|..:|
Mouse   230 -NFDETKDLDLDDIVRYIQGSERVVIMCASGDTIRRIMLAVHRHGMTSGDYAFFNIELFNSSSYG 293

  Fly   353 DKGWEMKDEHDAKARKAYEALLRVSLLQPTSPKFQDFA----DNVRENALYDYNYTFGEGEEVNF 413
            |..|...|:||::|::||.:|..|:||:...|:|:.|:    .:|.:..|.:.:|       ||.
Mouse   294 DGSWRRGDKHDSEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNEEDY-------VNM 351

  Fly   414 FIGAFYDGVYLLGMALNETLTEGGDIRDGVNITRRMWNRTFEGITGHVRIDDNGDRDADYSILDL 478
            |:..|:|.:.|..:||:|.|..|...:||..|.::.||||||||.|.|.||.||||..|:|::.:
Mouse   352 FVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVVAM 416

  Fly   479 -DPINGKFSVVAHYSGVHKVYSAVHGKKIHW-------PGGREEPPPDVPPCGFLGNSTDCVGNF 535
             |...|...|:..|.|....:......|..|       ...|.....:..||...|...:     
Mouse   417 TDTEAGTQEVIGDYFGKEGRFQMRSNVKYPWGPLKLRLDETRIVEHTNSSPCKSSGGLEE----- 476

  Fly   536 STIMYSVFGLLLFLGLVFLVICLLQKQMKLSKELNN 571
            |.:...|.|.||..||: :.....:|:.:::.|..|
Mouse   477 SAVTGIVVGALLGAGLL-MAFYFFRKKYRITIERRN 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368 131/428 (31%)
ANF_receptor 107..479 CDD:279440 121/392 (31%)
PKc_like 616..885 CDD:304357
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003
CYCc 918..1109 CDD:214485
Guanylate_cyc 945..1131 CDD:278633
Npr3NP_032754.2 PBP1_NPR_C_like 49..440 CDD:107381 131/431 (30%)
ANF_receptor 66..419 CDD:279440 121/393 (31%)
TM_EphA1 471..502 CDD:214014 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.876977 Normalized mean entropy S7115
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.