Sequence 1: | NP_726013.2 | Gene: | CG3216 / 37376 | FlyBaseID: | FBgn0034568 | Length: | 1161 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005255136.1 | Gene: | ADCY9 / 115 | HGNCID: | 240 | Length: | 1372 | Species: | Homo sapiens |
Alignment Length: | 265 | Identity: | 80/265 - (30%) |
---|---|---|---|
Similarity: | 128/265 - (48%) | Gaps: | 45/265 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 914 RQLSLEKQRTEELLYQILPRPVAQQLM-AGD-----------------------------LVEP- 947
Fly 948 --EEFSSVTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSG 1010
Fly 1011 LPEPNGDKHAREIALMALDILRAVSSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGD 1075
Fly 1076 TVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVELKGKGTVT-------TYWLNSTS 1133
Fly 1134 EGEAR 1138 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3216 | NP_726013.2 | PBP1_NPR_like | 90..496 | CDD:107368 | |
ANF_receptor | 107..479 | CDD:279440 | |||
PKc_like | 616..885 | CDD:304357 | |||
TyrKc | 627..877 | CDD:197581 | |||
HNOBA | <882..939 | CDD:285003 | 7/24 (29%) | ||
CYCc | 918..1109 | CDD:214485 | 70/223 (31%) | ||
Guanylate_cyc | 945..1131 | CDD:278633 | 67/195 (34%) | ||
ADCY9 | XP_005255136.1 | DUF2339 | <118..>301 | CDD:287113 | |
CYCc | 326..544 | CDD:214485 | 70/222 (32%) | ||
Guanylate_cyc | 385..573 | CDD:278633 | 66/192 (34%) | ||
CYCc | 1043..1243 | CDD:214485 | |||
Guanylate_cyc | 1069..1260 | CDD:278633 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |