DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and ADCY3

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:XP_011530791.1 Gene:ADCY3 / 109 HGNCID:234 Length:1186 Species:Homo sapiens


Alignment Length:366 Identity:107/366 - (29%)
Similarity:162/366 - (44%) Gaps:75/366 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   841 FRPL--------IRERECPPDLLELMEKCWADNQEERPTFSTIRSNIRTIMKGFCENLMDDLLNR 897
            :||:        .||.:.|...||.|       |...|..:...|.:..:...:...:|..|:..
Human   836 WRPVFDEYDHKRFREHDLPMVALEQM-------QGFNPGLNGTDSRLPLVPSKYSMTVMVFLMML 893

  Fly   898 MEQYANNLESLVEEKTRQLSL-------EKQR-------TEELLYQILPRPVAQQLMAGDLVEPE 948
            ...|   ....||:..|.|.|       :|:|       .|.|:..:||..||:..: |.....|
Human   894 SFYY---FSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFL-GSKKRDE 954

  Fly   949 EFSSVT-----IYFSDIVGF----TELCARSSPMDVVNFLNDLYSTFDRIIG---FYDVYKVETI 1001
            |..|.|     :.|:.:..|    ||....:..::.:.|||::.|.||.::.   |..:.|::||
Human   955 ELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTI 1019

  Fly  1002 GDAYLVVSGL-PEPN---------GDKHARE----------IALMALDILRAVS--SFNLRHKPE 1044
            |..|:..||: |:.|         .||..||          .||...|.|..::  |||      
Human  1020 GSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFALAMKDTLTNINNQSFN------ 1078

  Fly  1045 YKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQ 1109
             ...:||||:.|.|.|||:|.:.|||.::|:|||.||||||||..|.|.|...|:.||.::| |:
Human  1079 -NFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYG-FR 1141

  Fly  1110 MEQRGDVELKGKGTVTTYWLNSTSEGEARPPTPQILTTDEV 1150
            ..:||.:.:||||.:.|::|....:....|..|.:....:|
Human  1142 FVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQV 1182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357 11/51 (22%)
TyrKc 627..877 CDD:197581 10/43 (23%)
HNOBA <882..939 CDD:285003 16/70 (23%)
CYCc 918..1109 CDD:214485 77/238 (32%)
Guanylate_cyc 945..1131 CDD:278633 76/219 (35%)
ADCY3XP_011530791.1 AC_N <44..303 CDD:292831
CYCc 273..490 CDD:214485
Guanylate_cyc 310..516 CDD:278633
CYCc 925..1143 CDD:214485 75/226 (33%)
Guanylate_cyc 956..1163 CDD:278633 74/214 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.