DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and ADCY1

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_066939.1 Gene:ADCY1 / 107 HGNCID:232 Length:1119 Species:Homo sapiens


Alignment Length:215 Identity:72/215 - (33%)
Similarity:121/215 - (56%) Gaps:17/215 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   907 SLVEEKTRQLSLEKQRTEELLYQILPRPVAQQLMAGDLVEPEE----------FSSVTIYFSDIV 961
            |.:|::.| |..|.::.|.||..:|||.||.: |..|.::|.|          ..:|:|.|:|||
Human   248 SCIEDRLR-LEDENEKQERLLMSLLPRNVAME-MKEDFLKPPERIFHKIYIQRHDNVSILFADIV 310

  Fly   962 GFTELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLPEPNGDKHAREIALM 1026
            |||.|.::.:..::|..||:|:..||.:.......:::.:||.|..||||.:|..| ||.....|
Human   311 GFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTD-HAHCCVEM 374

  Fly  1027 ALDILRAVSSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGK 1091
            .||::..::|  :....|..:.:|:|:|:|.|..||:|.:...|.::.:.|..|:.||:.|.|||
Human   375 GLDMIDTITS--VAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGK 437

  Fly  1092 IHVSSATKAILDKFGTFQME 1111
            :|::..|.|.|:  |.:::|
Human   438 VHITKTTLACLN--GDYEVE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003 13/31 (42%)
CYCc 918..1109 CDD:214485 67/200 (34%)
Guanylate_cyc 945..1131 CDD:278633 57/177 (32%)
ADCY1NP_066939.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
AC_N <161..292 CDD:292831 17/45 (38%)
CYCc 258..453 CDD:214485 67/200 (34%)
Guanylate_cyc 294..476 CDD:278633 55/167 (33%)
Interaction with calmodulin. /evidence=ECO:0000250 493..520
CYCc 826..1037 CDD:214485
Guanylate_cyc 859..1056 CDD:278633
Interaction with calmodulin. /evidence=ECO:0000250 1024..1047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.