DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and Adcy4

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_001348533.1 Gene:Adcy4 / 104110 MGIID:99674 Length:1077 Species:Mus musculus


Alignment Length:304 Identity:95/304 - (31%)
Similarity:147/304 - (48%) Gaps:48/304 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   882 IMKGFCENLMDDLLNRMEQYANNLESLVEEKTRQLSLEKQRTEELLYQILPRPVAQQ-------- 938
            ::..:.:.||:..|.  ..:...|.||  ...|:|..||:..|.||..|||..:|::        
Mouse   186 VVGAYHKALMERALR--ATFREALSSL--HSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMAR 246

  Fly   939 LMAGDLVEPEEFSS-----------VTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIGF 992
            |.||....||..::           |::.::||||||.|.:..||.::|..||:|:..||:|...
Mouse   247 LQAGQRSRPENTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKE 311

  Fly   993 YDVYKVETIGDAYLVVSGLPEPNGDKHAREIALMALDILRAVSSFNLRHKPEYKIQIRIGMHSGS 1057
            ::..:::.:||.|..|||||....| ||.....|.||:.||:.  .||......|.:|:|:||||
Mouse   312 HECMRIKILGDCYYCVSGLPLSLPD-HAINCVRMGLDMCRAIR--KLRVATGVDINMRVGVHSGS 373

  Fly  1058 VCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVE----- 1117
            |..||:|.:...|.::...|..|:.||:.|.||::|::.||.|:|  .|.:.:| |.|.|     
Mouse   374 VLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALL--AGAYAVE-RADTEHRDPY 435

  Fly  1118 LKGKGTVTTYWLNSTSEGEARPPT--------------PQILTT 1147
            |:..|..|...::..:|.|....|              |.:|.|
Mouse   436 LRELGEPTYLVIDPRAEEEDEKGTAKGLLSSLEGHTMRPSLLMT 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357 0/2 (0%)
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003 17/64 (27%)
CYCc 918..1109 CDD:214485 74/209 (35%)
Guanylate_cyc 945..1131 CDD:278633 69/201 (34%)
Adcy4NP_001348533.1 AC_N <115..246 CDD:318454 17/63 (27%)
Guanylate_cyc 264..418 CDD:306677 58/156 (37%)
DUF1053 479..580 CDD:368844 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..524
Guanylate_cyc 866..1065 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.