DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and LOC100333871

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:XP_002666572.2 Gene:LOC100333871 / 100333871 -ID:- Length:243 Species:Danio rerio


Alignment Length:214 Identity:113/214 - (52%)
Similarity:151/214 - (70%) Gaps:0/214 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   930 ILPRPVAQQLMAGDLVEPEEFSSVTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIGFYD 994
            :||:.||..|..|..::.:.:.|.|::||||||||:|.:.|:|..||:|||.||:|||.||..:|
Zfish     1 MLPKQVADDLRLGKPMQAQSYVSATVFFSDIVGFTQLSSTSTPYQVVDFLNKLYTTFDEIIDNHD 65

  Fly   995 VYKVETIGDAYLVVSGLPEPNGDKHAREIALMALDILRAVSSFNLRHKPEYKIQIRIGMHSGSVC 1059
            |||||||||||:||||:|..||..||.|||.||||::....:|.:.|:|:.::|||.|:|||.|.
Zfish    66 VYKVETIGDAYMVVSGVPRENGILHASEIANMALDLVSVCKTFRIPHRPQTQLQIRAGIHSGPVV 130

  Fly  1060 AGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVELKGKGTV 1124
            |||||.|||.|||||||||||||||||.:..||..||:...:|::.|.:.:..||.:::||||.:
Zfish   131 AGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSSSAFYLLEEIGGYLLTCRGLLQVKGKGDM 195

  Fly  1125 TTYWLNSTSEGEARPPTPQ 1143
            .||||......:.:.|..|
Zfish   196 VTYWLEGKCSKDMKKPATQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003 4/8 (50%)
CYCc 918..1109 CDD:214485 101/178 (57%)
Guanylate_cyc 945..1131 CDD:278633 105/185 (57%)
LOC100333871XP_002666572.2 CYCc 1..179 CDD:214485 101/177 (57%)
Guanylate_cyc 16..202 CDD:278633 105/185 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D123766at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.