DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and gucy1b1

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_001238874.1 Gene:gucy1b1 / 100150304 ZFINID:ZDB-GENE-090313-160 Length:608 Species:Danio rerio


Alignment Length:628 Identity:166/628 - (26%)
Similarity:250/628 - (39%) Gaps:175/628 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 RLDVENISLQQFGIHSGRASIASFTSLPPQVYTTIGQFKGERVAIKKVNVKKVDLTPQLLWEIKQ 661
            ::|...| ||.||       ...|.......|.||.:..|..|.                 |..|
Zfish    60 KMDAGGI-LQMFG-------KMFFEFCQESGYDTILRVLGSNVR-----------------EFLQ 99

  Fly   662 ARDVSHEN--TVRFVG------ACIDLPRPTVLILTEYCSRGSLKDVLENEAIELDWNFRMSLIH 718
            ..|..|::  |: :.|      .|.|..:...|||..|..|..|:|::            :.:|.
Zfish   100 NLDALHDHLGTI-YPGMRAPSFRCTDAEKGNNLILHYYSEREGLQDIV------------IGIIK 151

  Fly   719 DIVKGMNYLHNSDV---AAHGKLRSCNCLIDGRFVLKISDF----------GL------RTLTTP 764
            .:.:   .:|.:::   ....|...|:.:   :|:::..|.          |.      .|..:|
Zfish   152 TVAQ---QIHGTEIEMKVIQPKSEECDHI---KFLIEEKDSEEEAFYEDLDGFEENGTQETRISP 210

  Fly   765 SDFVRDQNYYL-------------KLLWIAPELLPLTTIPGCCPATQRGDVYSFGIILEEIVNRG 816
            ..|.:...::|             .:..:.|:|.     ||.|                   |..
Zfish   211 YTFCKAFPFHLMFDKDLMLTQCGNAIFRVLPQLQ-----PGVC-------------------NLS 251

  Fly   817 GPYQEARQQMD--VHTILHKVRQCNGFRPLIRERECPPDLLELMEKCWADNQEE--RPTFSTIRS 877
            ..:...|..:|  .|.||..:....    ::|.:|      .|:....|:|::|  ....|.:|.
Zfish   252 SVFSLVRPHIDFSFHGILSHINTVF----VLRSKE------GLLNVETAENEDELTGTEISCLRL 306

  Fly   878 NIRTIMKGFCENL----------MDDLLNR-----------------------MEQY--ANNLES 907
            ..:.|.....||:          :|||..|                       .|:|  ...||.
Zfish   307 KGQMISLPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEI 371

  Fly   908 L---VEEKTRQLSLEKQRTEELLYQILPRPVAQQLMAGDLVEPEEFSSVTIYFSDIVGFTELCAR 969
            |   ::...|.|..||::|:.|||.:||..||.:|.....|..:.:.:|||.||.||||...|::
Zfish   372 LTDRLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSK 436

  Fly   970 SSPMD----VVNFLNDLYSTFDRIIGFYD---VYKVETIGDAYLVVSGLPEPNGDKHAREIALMA 1027
            .:..:    :||.|||:|:.||.:.....   ||||||:||.|:.||||||| ...||:.|..:|
Zfish   437 HASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEP-CTHHAKSICHLA 500

  Fly  1028 LDILRAVSSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKI 1092
            ||::.......:...|   :||.||:|:|.|..||:|::||.|||||:|||..||.|:||:.|||
Zfish   501 LDMMEIAGQVKVDEDP---VQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKI 562

  Fly  1093 HVSSATKAILDKFGT----FQMEQRGDVELKGKGTVTTYWLNS 1131
            :||..|...|.....    |.:|.||.|.:|||......|..|
Zfish   563 NVSEYTYRCLQSVENADPQFHLEYRGPVTMKGKKEPMKVWFLS 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357 52/312 (17%)
TyrKc 627..877 CDD:197581 49/293 (17%)
HNOBA <882..939 CDD:285003 24/94 (26%)
CYCc 918..1109 CDD:214485 85/201 (42%)
Guanylate_cyc 945..1131 CDD:278633 83/196 (42%)
gucy1b1NP_001238874.1 HNOB 2..166 CDD:285002 29/146 (20%)
HNOBA 207..406 CDD:285003 46/232 (20%)
CYCc 385..584 CDD:214485 86/202 (43%)
Guanylate_cyc 412..605 CDD:278633 83/196 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.