DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3216 and gucy1a2

DIOPT Version :9

Sequence 1:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster
Sequence 2:NP_001120379.1 Gene:gucy1a2 / 100145454 XenbaseID:XB-GENE-1011801 Length:712 Species:Xenopus tropicalis


Alignment Length:718 Identity:197/718 - (27%)
Similarity:282/718 - (39%) Gaps:195/718 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 RTFEGITGHVRIDDNGDRDADYSILDLDPINGKFSVVAHYSGVHKVYSAVHGKKIHWPGGREEPP 516
            ||.:....||    .|.|||:.::              |.:.|...|:...||         |..
 Frog    89 RTLQCYEHHV----IGCRDAERNL--------------HNASVRCAYAENSGK---------EDA 126

  Fly   517 PDVPPCGFLGNSTDCVGNFSTIMYSVFGLLLFLGLVFLVICLLQKQMKLSKELNNMSWRVRPDDV 581
            .|:  .|.|    .|..|...|.:.  .|....|..|..||..:.:.                 |
 Frog   127 EDI--SGIL----QCTANMLGIKFE--ELQERFGEEFFSICFEENER-----------------V 166

  Fly   582 LIEMGGMFGSKGGLQRLDVENISLQQFGIHSGRASIASFTSLPPQVYTTIGQFKGERVAIKKVNV 646
            |..:||                :|..|        ...|.:|...:.|:||         ::|.:
 Frog   167 LRAVGG----------------TLHDF--------FNGFDALLEHIRTSIG---------RQVTL 198

  Fly   647 KKVDLTPQLLWEIKQARDVSHENTVRFVGACIDLPRPTVLI-------LTEYCSRGSLKDV---- 700
            :    :|..|                    |.:|...|:|:       :..:..:|.:|..    
 Frog   199 E----SPSFL--------------------CKELADGTLLLSCFHLHHIVGFAMKGLIKAAGKKI 239

  Fly   701 --LENEAIELDWNFRMSLIHDIVKGMNYLHNSDVAAHGKLRSCNCLIDGRFVLKISDFG------ 757
              |:.|..::: |.......||::..|:               |||   .|.:|..|..      
 Frog   240 YQLKVEVEQVN-NVNEKPCPDIIRPGNF---------------NCL---TFKIKECDNANLMKAP 285

  Fly   758 -LRTLTTPSD-------FVRDQNYYLKLLWIAPELLPLTTIPGC-----CPATQRGDVY-SFGII 808
             |::...|||       |.|...::   |...|.:|.|....|.     |...:....: ||.|:
 Frog   286 LLQSSHIPSDLRISISTFCRAFPFH---LMFDPNMLILQLGEGLRKLIKCEVHKTMQFHDSFEIV 347

  Fly   809 -------LEEIVNRGGPYQEARQQMDVHTILH--KVRQCNGFRPLIREREC--------PPDLLE 856
                   .|:::.|.......|.:.|..|..:  ||.:..|....:.|...        ...|.|
 Frog   348 SPKISCTFEQVLLRLSTPFVIRNKPDAPTFENKDKVMEVKGQMIYVPESSSILFLGSPRVDKLDE 412

  Fly   857 LMEKCWADNQEERPTFSTIRSNIRTIMKGFCENLMDDLLNRMEQYANNLESLVEEKTRQ-LSLEK 920
            ||.:  ..:..:.|.....|.   .|:.|......|.|..||::....|     |||.| |..||
 Frog   413 LMGR--GLHLSDIPIHDATRD---VILVGEQAKAQDGLKKRMDKLKATL-----EKTHQALEEEK 467

  Fly   921 QRTEELLYQILPRPVAQQLMAGDLVEPEEFSSVTIYFSDIVGFTELCARSSPMDVVNFLNDLYST 985
            ::|.:|||.|.|..|||||..|..|:..:|..||:.||||||||.:||:.:||.|::.||:||:.
 Frog   468 KKTVDLLYSIFPGDVAQQLWEGKSVQARKFDDVTMLFSDIVGFTAVCAQCTPMQVISMLNELYTR 532

  Fly   986 FDRIIGFYDVYKVETIGDAYLVVSGLPEPNGDKHAREIALMALDILRAVSSFNLRHKPEYKIQIR 1050
            ||...||.|:||||||||||.|.:||.. ..:.||:.||||||.::..  |..:.......|::|
 Frog   533 FDYQCGFLDIYKVETIGDAYCVAAGLLR-QSNSHAKPIALMALKMMEL--SEEVLTPDGRPIKMR 594

  Fly  1051 IGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGD 1115
            ||:|||||.|||||.:||.|||||:.|..||:.||...|.:|:||..|..:|.....|....|..
 Frog   595 IGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKDEANFHFVPRSR 659

  Fly  1116 VEL 1118
            .||
 Frog   660 EEL 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368 10/43 (23%)
ANF_receptor 107..479 CDD:279440 8/26 (31%)
PKc_like 616..885 CDD:304357 57/318 (18%)
TyrKc 627..877 CDD:197581 53/299 (18%)
HNOBA <882..939 CDD:285003 23/57 (40%)
CYCc 918..1109 CDD:214485 94/190 (49%)
Guanylate_cyc 945..1131 CDD:278633 84/174 (48%)
gucy1a2NP_001120379.1 Pap_E4 30..>86 CDD:367150
HNOB <132..248 CDD:377902 31/195 (16%)
HNOBA 296..486 CDD:369471 49/202 (24%)
Guanylate_cyc 492..679 CDD:306677 84/174 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.