DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15651 and FKTN

DIOPT Version :9

Sequence 1:NP_611531.2 Gene:CG15651 / 37375 FlyBaseID:FBgn0034567 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_011516670.1 Gene:FKTN / 2218 HGNCID:3622 Length:488 Species:Homo sapiens


Alignment Length:313 Identity:52/313 - (16%)
Similarity:90/313 - (28%) Gaps:138/313 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 LDGQFSSSNTSLPLITDIDLFGCERTTKSCIGSVYNER---------------------PYYS-- 395
            |||..|.|.|.:||     .:.|:..|.:....|::||                     |:..  
Human   147 LDGIDSLSGTEIPL-----HYICKLATHAIHLVVFHERSGNYLWHGHLRLKEHIDRKFVPFRKLQ 206

  Fly   396 ---YLGKHTPP--------------------------------CCLDKLRTTFNHVLEE------ 419
               |.|....|                                |...:.|..|...|::      
Human   207 FGRYPGAFDRPELQQVTVDGLEVLIPKDPMHFVEEVPHSRFIECRYKEARAFFQQYLDDNTVEAV 271

  Fly   420 ----------------FENVGIRYWLDNRALQSAIETNHLSPDAYDIDISFNVQDLER------- 461
                            ...:|:.:||.:..........::.|.:.|:|:...:||.:.       
Human   272 AFRKSAKELLQLAAKTLNKLGVPFWLSSGTCLGWYRQCNIIPYSKDVDLGIFIQDYKSDIILAFQ 336

  Fly   462 -------------SNAMKKS-QSKPYVDNEGFYWIKATDGHHFRVQFSKPNQVGVNLLPYSISGT 512
                         .::::.| |.|..|..:.|::.:.|| |.:.                  .||
Human   337 DAGLPLKHKFGKVEDSLELSFQGKDDVKLDVFFFYEETD-HMWN------------------GGT 382

  Fly   513 EAKASGFFGWKARSFSADYL---HPMSTVLFLGKSVMCP------NNVLEYLE 556
            :||.    |.|.:..|..||   ||...|:.:...:..|      |:...:|:
Human   383 QAKT----GKKFKYESNKYLFIKHPNLPVIKVMNIITMPPECEVLNSTSHFLK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15651NP_611531.2 None
FKTNXP_011516670.1 LicD 289..>327 CDD:294823 7/37 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1115738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.