DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15651 and W02B3.7

DIOPT Version :9

Sequence 1:NP_611531.2 Gene:CG15651 / 37375 FlyBaseID:FBgn0034567 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_497239.2 Gene:W02B3.7 / 189107 WormBaseID:WBGene00020927 Length:325 Species:Caenorhabditis elegans


Alignment Length:259 Identity:47/259 - (18%)
Similarity:83/259 - (32%) Gaps:82/259 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 QEGRRLF---ASFH-------TKQRRMDLRRRQFREMYKKLQIKRIVRR-AYRVPGKAQA----- 342
            ||...|.   :.||       ||...:|.....|.:       |.|.:| ..|:.|..|.     
 Worm    84 QENAHLLQKDSRFHVVNYKNSTKTDHLDFEVTTFTK-------KSIPKRFGARIVGNVQVPLDIQ 141

  Fly   343 --REVWGQGHGLVLDGQFSSSNTSLPLITDIDLFGCERTTKSCIGSVYNERPYYSYLGKHT---- 401
              ...|.:  .:|||.:...:..|.|.....||        :.:.:|..|...:.:|...|    
 Worm   142 QFMGFWQR--SMVLDCKKERNEISQPSTASNDL--------AALQNVLIENGMFPFLNGRTLLNW 196

  Fly   402 -PPCCLDKLRTTFNHVLEEF----ENVGIRYWLDN----RALQSAIETNHLSPDAYDIDISFN-- 455
             ..|       |..|.:..|    .|..:.: |:|    ::....::.|....:...|.::.|  
 Worm   197 YKEC-------TTKHEIFNFMVMASNFNLNF-LENLEKGQSKLKLVQKNRTVGNGLRITVALNEV 253

  Fly   456 -------VQDLE--------------RSNAMKKSQSKPY--VDNEG-FYWIKATDGHHFRVQFS 495
                   .::|.              :::.::.|...|:  .|..| .:||..|.|.....:|:
 Worm   254 KAHIGLLYKELNEDGSVVHWTKGNNFKNHTIRFSTYDPWCSTDIHGHLFWISCTPGTRIAEEFA 317



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1115738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.