DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15651 and T07A5.1

DIOPT Version :10

Sequence 1:NP_611531.2 Gene:CG15651 / 37375 FlyBaseID:FBgn0034567 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_499278.2 Gene:T07A5.1 / 188207 WormBaseID:WBGene00011554 Length:379 Species:Caenorhabditis elegans


Alignment Length:99 Identity:23/99 - (23%)
Similarity:38/99 - (38%) Gaps:23/99 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 LITDIDLFGCERTTKSCIGSVYNERPYYSYLGKHTPPCCLDK--LRTTF----NHVLEEFENVGI 425
            |:..:|  ..|:|:|.|:.::.:       :....|...:||  |:..:    .|:.|....:||
 Worm    35 LVVSLD--SKEKTSKECLSNLQS-------VSIPVPALIIDKTVLKAIYQENCEHIFERKIKIGI 90

  Fly   426 --RYW--LDNRALQSAIE----TNHLSPDAYDID 451
              |.|  :.|....|..|    .|..|.|....|
 Worm    91 DKRNWKLIANHNESSIFECIRMENKTSNDYLQFD 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15651NP_611531.2 None
T07A5.1NP_499278.2 LicD 204..>235 CDD:470175
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.