DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15651 and fktn

DIOPT Version :10

Sequence 1:NP_611531.2 Gene:CG15651 / 37375 FlyBaseID:FBgn0034567 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001096364.1 Gene:fktn / 100124956 XenbaseID:XB-GENE-971788 Length:460 Species:Xenopus tropicalis


Alignment Length:47 Identity:11/47 - (23%)
Similarity:22/47 - (46%) Gaps:5/47 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TTLMHRASLACTSNI-FNQTSIEKLPDKVILHIFSYLSH----LEIC 48
            |.::..|.....:|: |....|:...|:.:::|..|:|.    |:.|
 Frog    39 TDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15651NP_611531.2 None
fktnNP_001096364.1 FKTN_N 1..277 CDD:466166 11/47 (23%)
LicD 291..>326 CDD:470175
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.