DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15651 and fktn

DIOPT Version :10

Sequence 1:NP_611531.2 Gene:CG15651 / 37375 FlyBaseID:FBgn0034567 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001036159.2 Gene:fktn / 100006345 ZFINID:ZDB-GENE-070410-96 Length:457 Species:Danio rerio


Alignment Length:164 Identity:33/164 - (20%)
Similarity:59/164 - (35%) Gaps:44/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 IRYWLDNRALQSAIETNHLSPDAYDIDISFNVQDLERSNAMKKSQSKPYVDNEGFYWIKATDGHH 489
            :.:||.:..........::.|.:.|:|:...::|. |.:.:...|             ||  |..
Zfish   290 VPFWLSSGTCLGWYRQCNIIPYSKDVDVGIWIKDY-RPDIIPAFQ-------------KA--GLP 338

  Fly   490 FRVQFSKPNQVGVNLLPYSISGTEAKASGFF-----------GWKARS---FSADYLHPMSTVL- 539
            .:.:|.|..    :.|..|..|.:.|...||           |.:|:|   |.  |:.|..::. 
Zfish   339 LKHKFGKVE----DSLELSFQGNDVKLDIFFFYDDGDVVWNGGTQAKSGRKFK--YVFPRFSLCW 397

  Fly   540 --FLGKSVMCPNNVLEYLE-----EKRIRVKSAD 566
              |:...|..|....:|:.     :..|.||:.|
Zfish   398 TEFMELKVQVPCETEDYVRANYGPDWNIPVKTWD 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15651NP_611531.2 None
fktnNP_001036159.2 FKTN_N 1..275 CDD:466166
LicD 291..>324 CDD:470175 5/32 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.