DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15651 and fktn

DIOPT Version :9

Sequence 1:NP_611531.2 Gene:CG15651 / 37375 FlyBaseID:FBgn0034567 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001036159.2 Gene:fktn / 100006345 ZFINID:ZDB-GENE-070410-96 Length:457 Species:Danio rerio


Alignment Length:164 Identity:33/164 - (20%)
Similarity:59/164 - (35%) Gaps:44/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 IRYWLDNRALQSAIETNHLSPDAYDIDISFNVQDLERSNAMKKSQSKPYVDNEGFYWIKATDGHH 489
            :.:||.:..........::.|.:.|:|:...::|. |.:.:...|             ||  |..
Zfish   290 VPFWLSSGTCLGWYRQCNIIPYSKDVDVGIWIKDY-RPDIIPAFQ-------------KA--GLP 338

  Fly   490 FRVQFSKPNQVGVNLLPYSISGTEAKASGFF-----------GWKARS---FSADYLHPMSTVL- 539
            .:.:|.|..    :.|..|..|.:.|...||           |.:|:|   |.  |:.|..::. 
Zfish   339 LKHKFGKVE----DSLELSFQGNDVKLDIFFFYDDGDVVWNGGTQAKSGRKFK--YVFPRFSLCW 397

  Fly   540 --FLGKSVMCPNNVLEYLE-----EKRIRVKSAD 566
              |:...|..|....:|:.     :..|.||:.|
Zfish   398 TEFMELKVQVPCETEDYVRANYGPDWNIPVKTWD 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15651NP_611531.2 None
fktnNP_001036159.2 LicD 291..>324 CDD:294823 5/32 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1115738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.