DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9313 and FY

DIOPT Version :9

Sequence 1:NP_001286657.1 Gene:CG9313 / 37374 FlyBaseID:FBgn0034566 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001318555.1 Gene:FY / 831191 AraportID:AT5G13480 Length:657 Species:Arabidopsis thaliana


Alignment Length:305 Identity:68/305 - (22%)
Similarity:102/305 - (33%) Gaps:87/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 AHDY----RYWEDPADEFREG-EGNLLPLWKFQYDKTK------KMNVTDILFNPSYYDL-FAVC 378
            |||.    ..|....:....| :|..|..|:...:..|      |.::.|:.|..:  || |..|
plant   174 AHDQPIRSMVWSHNENYMVSGDDGGTLKYWQNNMNNVKANKTAHKESIRDLSFCKT--DLKFCSC 236

  Fly   379 FGS-----HDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCG--VMCCDIHPTYPFLAVIGLYDGNV 436
            ...     .||.|..:|..|                |..|  |...|.|||...| |.|..|..|
plant   237 SDDTTVKVWDFTKCVDESSL----------------TGHGWDVKSVDWHPTKSLL-VSGGKDQLV 284

  Fly   437 AVYNLREDCKEPLYVSRGVNCKHG--ECVWQIKWGLDMADGEVNFFSVSSDGRVFNWILMQNKLW 499
            .:::.|.        .|.:...||  ..|..:||              :.:|   ||:|..:|  
plant   285 KLWDTRS--------GRELCSLHGHKNIVLSVKW--------------NQNG---NWLLTASK-- 322

  Fly   500 VTTIITLYRENGLVDGPDGTKVTLKS------GGSCMVFHPVDNKIFLVGTECGYIYKCSTAFSS 558
             ..||.||...        |...|:|      ..:.:.:||...:.|:.|:..|.|........:
plant   323 -DQIIKLYDIR--------TMKELQSFRGHTKDVTSLAWHPCHEEYFVSGSSDGSICHWIVGHEN 378

  Fly   559 KYLMTYYAHNMSVYRIDFNRFNSNIFVSCGA--DWMVKVWEDMRP 601
            ..:....||:.||:.:.::...   ::.|..  |...|.|...||
plant   379 PQIEIPNAHDNSVWDLAWHPIG---YLLCSGSNDHTTKFWCRNRP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9313NP_001286657.1 WD40 <353..706 CDD:225201 60/273 (22%)
WD40 repeat 362..412 CDD:293791 12/55 (22%)
WD40 413..640 CDD:295369 46/201 (23%)
WD40 repeat 415..454 CDD:293791 10/38 (26%)
WD40 repeat 463..505 CDD:293791 9/41 (22%)
WD40 repeat 513..557 CDD:293791 9/49 (18%)
WD40 repeat 571..608 CDD:293791 7/33 (21%)
WD40 repeat 613..654 CDD:293791
FYNP_001318555.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.