DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9313 and dnai1.1

DIOPT Version :9

Sequence 1:NP_001286657.1 Gene:CG9313 / 37374 FlyBaseID:FBgn0034566 Length:740 Species:Drosophila melanogaster
Sequence 2:XP_021324725.1 Gene:dnai1.1 / 570363 ZFINID:ZDB-GENE-040910-7 Length:105 Species:Danio rerio


Alignment Length:92 Identity:42/92 - (45%)
Similarity:62/92 - (67%) Gaps:7/92 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   634 KVHVFDLNVNKYKAICIQAVVPKRKNKLTRLSFNEKLAFIVVGDEKGVTTSLKLSPNLRMMVKPP 698
            :||||||::|:::|:|.|.|| ..|..||.:.||.....|:||:::|...|||||||||   |.|
Zfish    18 QVHVFDLSINRFEALCQQRVV-STKRHLTCIEFNPVHPIIIVGNDRGRVISLKLSPNLR---KNP 78

  Fly   699 KKQLYLDQNT---LQIGKLEKLLSLVR 722
            |::...:.:|   ::|.|:||||.|:|
Zfish    79 KEEKGKEPSTGAEVEIAKMEKLLILMR 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9313NP_001286657.1 WD40 <353..706 CDD:225201 33/71 (46%)
WD40 repeat 362..412 CDD:293791
WD40 413..640 CDD:295369 4/5 (80%)
WD40 repeat 415..454 CDD:293791
WD40 repeat 463..505 CDD:293791
WD40 repeat 513..557 CDD:293791
WD40 repeat 571..608 CDD:293791
WD40 repeat 613..654 CDD:293791 10/19 (53%)
dnai1.1XP_021324725.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 301 1.000 Domainoid score I1383
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 458 1.000 Inparanoid score I1548
OMA 1 1.010 - - QHG56518
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26170
orthoMCL 1 0.900 - - OOG6_104441
Panther 1 1.100 - - O PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4417
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.