DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9313 and CG13074

DIOPT Version :9

Sequence 1:NP_001286657.1 Gene:CG9313 / 37374 FlyBaseID:FBgn0034566 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_648835.1 Gene:CG13074 / 39760 FlyBaseID:FBgn0036567 Length:451 Species:Drosophila melanogaster


Alignment Length:501 Identity:99/501 - (19%)
Similarity:171/501 - (34%) Gaps:125/501 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 TQTIPPPRSQFGANVLQWVIYDSYMENFAESQKDGTKKEERKRGKREKKFRDKSAIAEQLNKKYL 307
            |.|.|||.||..|...|            |.....|:.|:|....::.:: |:.|:|     |:|
  Fly    31 TGTDPPPPSQDAATGTQ------------EKLHVATQTEQRVVSSKDVEY-DERALA-----KWL 77

  Fly   308 K--CWQILERMINQN-IYDDIAHD----------YRYWEDPADEFREGEGNLLPLWKFQYDKTKK 359
            :  |..:...::|.. :.:|:...          |.|.:.........:|  |.:|...:.....
  Fly    78 RQICPMVERELMNPTPLMEDLTMSQCRLEEKLQVYTYQKLIMGGAENSQG--LAIWLCVHTNNAP 140

  Fly   360 MNVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVM----CCDIH 420
            :             |.|.....||...:..:..|.||..:..|..:.:|.|:...:    |....
  Fly   141 V-------------LVATTVAPHDDWCEHVDQQLKLFVPQRMSVGNLVIYTEAKTLPLKSCLRSL 192

  Fly   421 PTYPFLAVI---GLYDGNVAVYNLRE--------DCKEPLYVSRGVNCKHGECVWQIKWGLDMAD 474
            .|.||...:   ...||.:.::...:        |.|: ||   .|:...|..| .:.|     .
  Fly   193 CTNPFNKTMFAGSTMDGELFIWLYEQARGSDSSVDIKQ-LY---SVSSTQGAAV-ALDW-----P 247

  Fly   475 GEVNFFSVSSDGRVFNWILMQNKL--WVTTIITLYRENGLVDGPDGTKVTLKSGGSCMVFHPVDN 537
            .|....:..::|.|..|.|.:...  |..|:                ..|:.|..:.||...:|:
  Fly   248 REHLLLACFANGSVRQWDLSRQMALDWEYTL----------------PATVSSEPTAMVTLGLDD 296

  Fly   538 KIFLVGTECGYIYKC------STAFSSKYLMTYYAHNMSVYRIDFNRFNSNIFV-SCGADWMVKV 595
              |:|||..|.:|:|      :.|.....|:....|...|..:.......|:|| ||...... .
  Fly   297 --FVVGTNDGGVYRCWNTGRQTAAIKQIKLLALRRHRFMVSTLLRTEMEGNLFVLSCDLSGQA-F 358

  Fly   596 WEDMRPDPLFIFDLGAAVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAVVPKRKNK 660
            :.|||   |...|:...:..:. .|:.:.:  |.:.:|.: :|          |     |.....
  Fly   359 YHDMR---LVDEDMAQLIVQIP-LPFKNVI--ACSRDGNI-IF----------C-----PANDGS 401

  Fly   661 LTRLSFNEKLAFIVVGDEKGVTTSLKLSPNLRMMVKPPKKQLYLDQ 706
            |.....::.....|.|..:|..:.::.|.|.|.::    ..||.|:
  Fly   402 LEYYRVSDGAHAHVKGGLRGKGSLIRSSDNGRWLI----AGLYGDE 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9313NP_001286657.1 WD40 <353..706 CDD:225201 72/376 (19%)
WD40 repeat 362..412 CDD:293791 10/49 (20%)
WD40 413..640 CDD:295369 51/250 (20%)
WD40 repeat 415..454 CDD:293791 10/53 (19%)
WD40 repeat 463..505 CDD:293791 9/43 (21%)
WD40 repeat 513..557 CDD:293791 13/49 (27%)
WD40 repeat 571..608 CDD:293791 10/37 (27%)
WD40 repeat 613..654 CDD:293791 5/40 (13%)
CG13074NP_648835.1 WD40 repeat 189..234 CDD:293791 9/48 (19%)
WD40 repeat 242..275 CDD:293791 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.