DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9313 and Dnai2

DIOPT Version :9

Sequence 1:NP_001286657.1 Gene:CG9313 / 37374 FlyBaseID:FBgn0034566 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster


Alignment Length:466 Identity:107/466 - (22%)
Similarity:183/466 - (39%) Gaps:103/466 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 EERKRGKREKKFRDKSAIAEQLNKKYLKCWQILERMINQ----NIYDDIAHDYRYWE--DPA--- 336
            |:..|.|| |..:|::.|.:.:|     ..:.:|..|:|    |||::      |:|  |||   
  Fly    88 EQTVRYKR-KIEKDENYITQVMN-----LTKPMEHYIHQNNAVNIYEN------YFENLDPAPLP 140

  Fly   337 --------DEFREGEGNLLPL----W---------------KFQYDKT-KKMNVTDILFNPSYYD 373
                    :.:|:.....:|:    |               :||.||: :|.|        ||  
  Fly   141 EPCKSRTVNVYRDPNPIKVPVKHLSWSPDGGIKMAVSHCDMRFQGDKSNQKCN--------SY-- 195

  Fly   374 LFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAV 438
                                 ::.|:||:.|...::.....:|.:.:...|...|.|:|:|.||.
  Fly   196 ---------------------IWEVENPNEPFLTLEPKVPCVCLEYNQKDPTSLVSGMYNGQVAA 239

  Fly   439 YNLREDCKEPLYVSRGVNCKHGECVWQIKWGLDMADGEVNFFSVSSDGRVFNWILMQNKLWVTTI 503
            ::.|.. |.|:.:|....| |.:.|..:.|....:..|  |||..|||:|. |       |.|..
  Fly   240 WDTRHG-KLPVMISEREVC-HRDPVNSVLWNNSKSGTE--FFSGGSDGQVL-W-------WDTRK 292

  Fly   504 ITLYRENGLVD--GPDGTKVTLKSGGSCMVFHPVDNKIFLVGTECGYIYKCS---TAFSSKYLMT 563
            :|...:..|:|  ..|...::...|.|.:.:.......|:.|||.|.::.|:   ...:.|..:.
  Fly   293 LTEPLDRLLMDPVKSDDQDLSRSYGISVLEYETTIPTRFMAGTEMGMLFSCNRKGKTPTEKIQIR 357

  Fly   564 YYAHNMSVYRIDFNRFNSNIFVSCGADWMVKVW-EDMRPDP-LFIFDLGAAVGDVKWAPYSSTVF 626
            ...|...||.|..|......|::.| ||..::| ||.|... ::.....:.:.|..|:....:.|
  Fly   358 MMCHLGPVYAITRNPAFVKNFLTVG-DWCARIWSEDCRESSIIWTKSSSSMLTDGAWSYTKVSQF 421

  Fly   627 AAVTTEGKVHVFDLNVNKYKAICIQAVVPKRKNKLTRLSFNEKLAFIVVGDEKGVTTSLKLSPNL 691
            .....:|.:..:||...:.:.:....|..:   .|..:..||...|:..|.:.|.|..:::|.|:
  Fly   422 FITRMDGVLDTWDLLQQQNEPVLTVKVCDE---PLYCVRTNENGKFVSCGSQLGATFLVEVSDNM 483

  Fly   692 RMMVKPPKKQL 702
            .|..|..|..|
  Fly   484 VMSAKNDKPLL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9313NP_001286657.1 WD40 <353..706 CDD:225201 84/358 (23%)
WD40 repeat 362..412 CDD:293791 6/49 (12%)
WD40 413..640 CDD:295369 57/233 (24%)
WD40 repeat 415..454 CDD:293791 12/38 (32%)
WD40 repeat 463..505 CDD:293791 13/41 (32%)
WD40 repeat 513..557 CDD:293791 10/48 (21%)
WD40 repeat 571..608 CDD:293791 12/38 (32%)
WD40 repeat 613..654 CDD:293791 6/40 (15%)
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 82/368 (22%)
WD40 repeat 162..208 CDD:293791 13/76 (17%)
WD40 212..469 CDD:295369 64/272 (24%)
WD40 repeat 215..254 CDD:293791 12/39 (31%)
WD40 repeat 262..304 CDD:293791 15/51 (29%)
WD40 repeat 318..355 CDD:293791 8/36 (22%)
WD40 repeat 365..401 CDD:293791 12/36 (33%)
WD40 repeat 408..433 CDD:293791 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435246
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.