DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and SME1

DIOPT Version :10

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_014802.3 Gene:SME1 / 854330 SGDID:S000005685 Length:94 Species:Saccharomyces cerevisiae


Alignment Length:67 Identity:14/67 - (20%)
Similarity:29/67 - (43%) Gaps:10/67 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PVAVKL--NNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNK--------YGDAFIRGNNVLYI 72
            ||.:.|  ..|:..:|.:...|.:||:.:::..|........|        .|...::|:|:..|
Yeast    26 PVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKILLKGDNITLI 90

  Fly    73 ST 74
            ::
Yeast    91 TS 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 13/64 (20%)
SME1NP_014802.3 Sm_E 7..92 CDD:212465 14/65 (22%)

Return to query results.
Submit another query.