DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and SMD1

DIOPT Version :9

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_011588.3 Gene:SMD1 / 852964 SGDID:S000003306 Length:146 Species:Saccharomyces cerevisiae


Alignment Length:38 Identity:11/38 - (28%)
Similarity:17/38 - (44%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICL 44
            |..|:.::....|.::|.||....|.|..:...||..|
Yeast     3 LVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAIL 40

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 10/37 (27%)
SMD1NP_011588.3 Sm_like 2..111 CDD:412267 11/38 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.