DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and AT4G30330

DIOPT Version :10

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_567844.1 Gene:AT4G30330 / 829156 AraportID:AT4G30330 Length:88 Species:Arabidopsis thaliana


Alignment Length:40 Identity:11/40 - (27%)
Similarity:22/40 - (55%) Gaps:1/40 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GVLACLDGYMNICLEQTEEY-VNGQLKNKYGDAFIRGNNV 69
            |.:...|.|||:.|::.||. :..:.:...|...::|:|:
plant    41 GRITGFDEYMNLVLDEAEEVSIKKKTRKPLGRILLKGDNI 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 11/40 (28%)
AT4G30330NP_567844.1 Sm_E 7..85 CDD:212465 11/40 (28%)

Return to query results.
Submit another query.