DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9344 and LSM6A

DIOPT Version :9

Sequence 1:	NP_611528.1	Gene:	CG9344 / 37372	FlyBaseID:	FBgn0034564	Length:	79	Species:	Drosophila melanogaster
Sequence 2:	NP_001327468.1	Gene:	LSM6A / 825150	AraportID:	AT3G59810	Length:	91	Species:	Arabidopsis thaliana

Alignment Length:	67	Identity:	55/67 - (82%)
Similarity:	59/67 - (88%)	Gaps:	0/67 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     8 SQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGNNVLYI 72
            :.|:..|.||||.||||:||||||.|.||||||||.:||||||||||||||||||||||||||||
plant    16 ADFLKSIRGRPVVVKLNSGVDYRGTLTCLDGYMNIAMEQTEEYVNGQLKNKYGDAFIRGNNVLYI 80

  Fly    73 ST 74
            ||
plant    81 ST 82

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9344	NP_611528.1	LSm6	8..73	CDD:212473	52/64 (81%)
LSM6A	NP_001327468.1	None

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	118	1.000	Domainoid score	I1936
eggNOG	1	0.900	-	-		E1_COG1958
Hieranoid	1	1.000	-	-
Homologene	1	1.000	-	-		H38271
Inparanoid	1	1.050	120	1.000	Inparanoid score	I1981
OMA	1	1.010	-	-		QHG54779
OrthoDB	1	1.010	-	-		D1627235at2759
OrthoFinder	1	1.000	-	-		FOG0000850
OrthoInspector	1	1.000	-	-		otm3474
orthoMCL	1	0.900	-	-		OOG6_102118
Panther	1	1.100	-	-	LDO	PTHR11021
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X3643
SwiftOrtho	1	1.000	-	-
TreeFam	1	0.960	-	-
	15	14.840