DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and LSM6B

DIOPT Version :9

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001078052.1 Gene:LSM6B / 818985 AraportID:AT2G43810 Length:91 Species:Arabidopsis thaliana


Alignment Length:69 Identity:53/69 - (76%)
Similarity:60/69 - (86%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGNNVLYI 72
            :.|:..|.|:||.||||:||||||:|.||||||||.:|||||||||||||.|||||:||||||||
plant    16 ADFLKSIRGKPVVVKLNSGVDYRGILTCLDGYMNIAMEQTEEYVNGQLKNTYGDAFVRGNNVLYI 80

  Fly    73 STQK 76
            ||.|
plant    81 STTK 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 49/64 (77%)
LSM6BNP_001078052.1 LSm6 14..81 CDD:212473 49/64 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1936
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38271
Inparanoid 1 1.050 120 1.000 Inparanoid score I1981
OMA 1 1.010 - - QHG54779
OrthoDB 1 1.010 - - D1627235at2759
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 1 1.000 - - otm3474
orthoMCL 1 0.900 - - OOG6_102118
Panther 1 1.100 - - LDO PTHR11021
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3643
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.