DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and AT2G18740

DIOPT Version :10

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_179464.1 Gene:AT2G18740 / 816389 AraportID:AT2G18740 Length:88 Species:Arabidopsis thaliana


Alignment Length:48 Identity:14/48 - (29%)
Similarity:26/48 - (54%) Gaps:2/48 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GVLACLDGYMNICLEQTEEY-VNGQLKNKYGDAFIRGNNV-LYISTQK 76
            |.:...|.|||:.|::.||. :....:...|...::|:|: |.::|.|
plant    41 GRITGFDEYMNLVLDEAEEVSIKKNTRKPLGRILLKGDNITLMMNTGK 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 12/43 (28%)
AT2G18740NP_179464.1 Sm_E 7..85 CDD:212465 12/43 (28%)

Return to query results.
Submit another query.