DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and lsm6

DIOPT Version :9

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001165068.1 Gene:lsm6 / 779701 XenbaseID:XB-GENE-1007008 Length:80 Species:Xenopus tropicalis


Alignment Length:77 Identity:66/77 - (85%)
Similarity:70/77 - (90%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGN 67
            ||:..|.|:.||.||||.||||:|||||||||||||||||.||||||||||||||||||||||||
 Frog     4 RKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGN 68

  Fly    68 NVLYISTQKRRV 79
            |||||||||||:
 Frog    69 NVLYISTQKRRM 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 57/64 (89%)
lsm6NP_001165068.1 LSm6 7..74 CDD:212473 57/66 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5607
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38271
Inparanoid 1 1.050 137 1.000 Inparanoid score I4433
OMA 1 1.010 - - QHG54779
OrthoDB 1 1.010 - - D1627235at2759
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 1 1.000 - - oto104086
Panther 1 1.100 - - LDO PTHR11021
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R669
SonicParanoid 1 1.000 - - X3643
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.