powered by:
Protein Alignment CG9344 and Snrpd2
DIOPT Version :9
Sequence 1: | NP_611528.1 |
Gene: | CG9344 / 37372 |
FlyBaseID: | FBgn0034564 |
Length: | 79 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102869.1 |
Gene: | Snrpd2 / 680309 |
RGDID: | 1593018 |
Length: | 118 |
Species: | Rattus norvegicus |
Alignment Length: | 71 |
Identity: | 16/71 - (22%) |
Similarity: | 28/71 - (39%) |
Gaps: | 20/71 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 VAVKLNNGVDYRGVLACLDGYMNICLEQTEEY----------------VNGQLKNKY-GDAFIRG 66
|.:...|.....|.:...|.:.|:.||..:|. || |::| ...|:||
Rat 42 VLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVN---KDRYISKMFLRG 103
Fly 67 NNVLYI 72
::|:.:
Rat 104 DSVIVV 109
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9344 | NP_611528.1 |
LSm6 |
8..73 |
CDD:212473 |
16/71 (23%) |
Snrpd2 | NP_001102869.1 |
Sm_D2 |
24..113 |
CDD:212467 |
16/71 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.