DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and AT2G14285

DIOPT Version :10

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001077889.1 Gene:AT2G14285 / 5007874 AraportID:AT2G14285 Length:61 Species:Arabidopsis thaliana


Alignment Length:46 Identity:24/46 - (52%)
Similarity:33/46 - (71%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGNNVLYI 72
            ::|:|.||.:|.|||:.|..||||::|||....|:..||.|||||:
plant     1 MEYKGFLASVDSYMNLQLGNTEEYIDGQLTGNLGEILIRCNNVLYV 46

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 24/46 (52%)
AT2G14285NP_001077889.1 Sm_F <1..48 CDD:212469 24/46 (52%)

Return to query results.
Submit another query.