DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and Lsm6

DIOPT Version :9

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_038953847.1 Gene:Lsm6 / 498934 RGDID:1561937 Length:98 Species:Rattus norvegicus


Alignment Length:68 Identity:57/68 - (83%)
Similarity:60/68 - (88%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGN 67
            ||:..|.|:.||.||||.||||:|||||||||||||||||.||||||||||||||||||||||||
  Rat     4 RKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGN 68

  Fly    68 NVL 70
            |.|
  Rat    69 NGL 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 55/63 (87%)
Lsm6XP_038953847.1 LSm6 7..69 CDD:212473 52/61 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334654
Domainoid 1 1.000 122 1.000 Domainoid score I5521
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38271
Inparanoid 1 1.050 137 1.000 Inparanoid score I4450
OMA 1 1.010 - - QHG54779
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 1 1.000 - - oto97402
orthoMCL 1 0.900 - - OOG6_102118
Panther 1 1.100 - - LDO PTHR11021
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3643
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.