powered by:
Protein Alignment CG9344 and Lsm10
DIOPT Version :9
Sequence 1: | NP_611528.1 |
Gene: | CG9344 / 37372 |
FlyBaseID: | FBgn0034564 |
Length: | 79 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610615.1 |
Gene: | Lsm10 / 36141 |
FlyBaseID: | FBgn0033554 |
Length: | 141 |
Species: | Drosophila melanogaster |
Alignment Length: | 41 |
Identity: | 11/41 - (26%) |
Similarity: | 19/41 - (46%) |
Gaps: | 4/41 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KEALSQFIN----QIHGRPVAVKLNNGVDYRGVLACLDGYM 40
|..:|..:| .:.|..|.:.|:|.....|::...||:|
Fly 9 KYLVSNTLNCWPVMLQGHSVLIDLHNETSVAGIIDVADGHM 49
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9344 | NP_611528.1 |
LSm6 |
8..73 |
CDD:212473 |
10/37 (27%) |
Lsm10 | NP_610615.1 |
LSm10 |
7..84 |
CDD:212480 |
11/41 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.