DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and SNRPG

DIOPT Version :10

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_573139.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster


Alignment Length:57 Identity:20/57 - (35%)
Similarity:29/57 - (50%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKR 77
            :|||.|....|:|...|.:||:.|:.|.|......||..|...||||:::.:....|
  Fly    19 LKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMVVIRGNSIVMVEALDR 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 19/51 (37%)
SNRPGNP_573139.1 Sm_G 5..74 CDD:212466 19/54 (35%)

Return to query results.
Submit another query.