DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and lsm6

DIOPT Version :10

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_594380.1 Gene:lsm6 / 2541997 PomBaseID:SPAC2F3.17C Length:75 Species:Schizosaccharomyces pombe


Alignment Length:66 Identity:42/66 - (63%)
Similarity:59/66 - (89%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGNNVLYI 72
            ::|:|::.|:.|.::|::||||:|:|:|||||||:.||:|||||||:..|.|||||||||||||:
pombe     6 NEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGKKTNVYGDAFIRGNNVLYV 70

  Fly    73 S 73
            |
pombe    71 S 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 41/64 (64%)
lsm6NP_594380.1 LSm6 4..71 CDD:212473 41/64 (64%)

Return to query results.
Submit another query.