DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and lsm-6

DIOPT Version :9

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001379827.1 Gene:lsm-6 / 190601 WormBaseID:WBGene00003080 Length:77 Species:Caenorhabditis elegans


Alignment Length:77 Identity:55/77 - (71%)
Similarity:68/77 - (88%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIR 65
            ||:::..::|:.::.|:||.||||:||||||:||||||||||.|||||||.||||:|||||||||
 Worm     1 MSKRQNPAEFLKKVIGKPVVVKLNSGVDYRGILACLDGYMNIALEQTEEYSNGQLQNKYGDAFIR 65

  Fly    66 GNNVLYISTQKR 77
            |||||||||..:
 Worm    66 GNNVLYISTSTK 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 50/64 (78%)
lsm-6NP_001379827.1 LSm6 6..73 CDD:212473 50/66 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156181
Domainoid 1 1.000 115 1.000 Domainoid score I3791
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38271
Inparanoid 1 1.050 122 1.000 Inparanoid score I3323
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54779
OrthoDB 1 1.010 - - D1627235at2759
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 1 1.000 - - oto19081
orthoMCL 1 0.900 - - OOG6_102118
Panther 1 1.100 - - LDO PTHR11021
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R669
SonicParanoid 1 1.000 - - X3643
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.