powered by:
Protein Alignment CG9344 and snr-3
DIOPT Version :9
Sequence 1: | NP_611528.1 |
Gene: | CG9344 / 37372 |
FlyBaseID: | FBgn0034564 |
Length: | 79 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495306.1 |
Gene: | snr-3 / 174072 |
WormBaseID: | WBGene00004916 |
Length: | 126 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 20/66 - (30%) |
Similarity: | 30/66 - (45%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 LSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGNNVLY 71
|.:|:.::....|.::|.||....|.:..:|..||..|......|..:...|.....|||||:.|
Worm 3 LVRFLMKLSHETVNIELKNGTQVSGTIMGVDVAMNTHLRAVSMTVKNKEPVKLDTLSIRGNNIRY 67
Fly 72 I 72
|
Worm 68 I 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9344 | NP_611528.1 |
LSm6 |
8..73 |
CDD:212473 |
19/65 (29%) |
snr-3 | NP_495306.1 |
Sm_D1 |
2..88 |
CDD:212471 |
20/66 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.