DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9344 and SNRPG

DIOPT Version :10

Sequence 1:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_312222.2 Gene:SNRPG / 1273262 VectorBaseID:AGAMI1_001571 Length:76 Species:Anopheles gambiae


Alignment Length:59 Identity:17/59 - (28%)
Similarity:32/59 - (54%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKR 77
            :::|||.|....|:|...|.:||:.::::.|......:|..|...||||:::.:....|
Mosquito    17 LSLKLNGGRVVSGILRGFDPFMNVVVDESIEECKDGTRNNIGMVVIRGNSIIMVEALDR 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9344NP_611528.1 LSm6 8..73 CDD:212473 16/53 (30%)
SNRPGXP_312222.2 Sm_G 5..74 CDD:212466 16/56 (29%)

Return to query results.
Submit another query.